Is it possible to put elements of array to hash in perl? -
example of file content:
>random sequence 1 consisting of 500 residues. vilvwrisemnptheiypevsyedrqpfrcfdeginmqmgqkscrncliftrnafaygiv hflewgillthiihcchqiqggcdctrhpvrfypqhrnddvdkpcqtkspmqvrygddsd; >random sequence 2 consisting of 500 residues. kaaatkkpwadtipyllctfmqtsglewlhtdynnfssvvcvryfeqfwvqcqdhvfvkn knwhqvlweeyavidsmnfawpplyqsvssnldstermmwwwvyyqfedniqirmewcni ysgflsreklelthnkcevcvdkfvrlvfkqtkwvrtmnnrrrvrfrgiyqqtaiqeyhv hqkiirypchvmqfhdpsapcdmtrqgkrmnfcfiiflytlyevkywmhfltylnclehr; >random sequence 3 consisting of 500 residues. aycscwrihnvvfqkdvvlgywghcwmswgsmnqpfhrqpynkyfcmapdwcnigtyawk i need algorithm build hash $hash{$key} = $value; lines starting > values , following lines keys.
what have tried:
open (data, "seq-at.txt") or die "blabla"; @data = <data>; %result = (); $k = 0; $i = 0; while($k != @data) { $info = @data[$k]; #istrina pirma elementa if(@data[$i] !=~ ">") { $key .= @data[$i]; $i++; } else { $k = $i; } $result{$key} = $value; } but doesn't work.
you don't have use array, can directly build hash:
use strict; use warnings; # ^- start code see errors , ambiguous # declare variables using "my" specify scope $filename = 'seq-at.txt'; # use 3 parameters open syntax avoid overwrite file: open $fh, '<', $filename or die "unable open '$filename' $!"; %hash; $hkey = ''; $hval = ''; while (<$fh>) { chomp; # remove newline \n (or \r\n) if (/^>/) { # when line start ">" # store key/value in hash if key isn't empty # (the key empty when first ">" encountered) $hash{$hkey} = $hval if ($hkey); # store line in $hval , clear $hkey ($hval, $hkey) = $_; } elsif (/\s/) { # when line isn't empty (or blank) # append line key $hkey .= $_; } } # store last key/val in hash if $hash{$hkey} = $hval if ($hkey); # display hash foreach (keys %hash) { print "key: $_\nvalue: $hash{$_}\n\n"; }
Comments
Post a Comment