Is it possible to put elements of array to hash in perl? -

-

example of file content:

>random sequence 1 consisting of 500 residues. vilvwrisemnptheiypevsyedrqpfrcfdeginmqmgqkscrncliftrnafaygiv hflewgillthiihcchqiqggcdctrhpvrfypqhrnddvdkpcqtkspmqvrygddsd;  >random sequence 2 consisting of 500 residues. kaaatkkpwadtipyllctfmqtsglewlhtdynnfssvvcvryfeqfwvqcqdhvfvkn knwhqvlweeyavidsmnfawpplyqsvssnldstermmwwwvyyqfedniqirmewcni ysgflsreklelthnkcevcvdkfvrlvfkqtkwvrtmnnrrrvrfrgiyqqtaiqeyhv hqkiirypchvmqfhdpsapcdmtrqgkrmnfcfiiflytlyevkywmhfltylnclehr;  >random sequence 3 consisting of 500 residues. aycscwrihnvvfqkdvvlgywghcwmswgsmnqpfhrqpynkyfcmapdwcnigtyawk

i need algorithm build hash $hash{$key} = $value; lines starting > values , following lines keys.

what have tried:

open (data, "seq-at.txt") or die "blabla"; @data = <data>; %result = (); $k = 0; $i = 0;  while($k != @data) {     $info = @data[$k]; #istrina pirma elementa     if(@data[$i] !=~ ">") {         $key .= @data[$i]; $i++;     } else {         $k = $i;     }     $result{$key} = $value; }

but doesn't work.

you don't have use array, can directly build hash:

use strict; use warnings; # ^- start code see errors , ambiguous  # declare variables using "my" specify scope $filename = 'seq-at.txt';   # use 3 parameters open syntax avoid overwrite file: open $fh, '<', $filename or die "unable open '$filename' $!";  %hash; $hkey = ''; $hval = '';  while (<$fh>) {     chomp; # remove newline \n (or \r\n)     if (/^>/) { # when line start ">"         # store key/value in hash if key isn't empty         # (the key empty when first ">" encountered)         $hash{$hkey} = $hval if ($hkey);         # store line in $hval , clear $hkey         ($hval, $hkey) = $_;     } elsif (/\s/) { # when line isn't empty (or blank)         # append line key         $hkey .= $_;     } }  # store last key/val in hash if $hash{$hkey} = $hval if ($hkey);  # display hash foreach (keys %hash) {     print "key: $_\nvalue: $hash{$_}\n\n"; }

Comments

Post a Comment

Popular posts from this blog

ios - RestKit 0.20 — CoreData: error: Failed to call designated initializer on NSManagedObject class (again) -

-
this error has shown on many times, seems. prominent answer issue seems restkit 0.20 — coredata: error: failed call designated initializer on nsmanagedobject class however, solution posted doesn't work me. let's start beginning: i want upload file server. want parse response make sure uploaded. if not, try again later. model has boolean variable called nsnumber *senttoserver purpose (in coredata, bool saved nsnumber ) . because don't know whether sending going successful, save entity coredata model first before sending via restkit. when post request successful, server returns json string this: {"id":14,"created":true} notice that, of course, id not set on coredata model yet, both id , created new informations model. here's model: @interface recording : nsmanagedobject @property (nonatomic, retain) nsstring * audiofilepath; @property (nonatomic, retain) nsdate * createdat; @property (nonatomic, retain) nsstring * deviceid; @...
Read more

java - Digest auth with Spring Security using javaconfig -

-
so i'm trying create digest authentication spring following documentation trying translate xml "requirements" in java requirements. let's have xml in docs: <bean id="digestfilter" class= "org.springframework.security.web.authentication.www.digestauthenticationfilter"> <property name="userdetailsservice" ref="jdbcdaoimpl"/> <property name="authenticationentrypoint" ref="digestentrypoint"/> <property name="usercache" ref="usercache"/> </bean> <bean id="digestentrypoint" class= "org.springframework.security.web.authentication.www.digestauthenticationentrypoint"> <property name="realmname" value="contacts realm via digest authentication"/> <property name="key" value="acegi"/> <property name="noncevalidityseconds" value="10"/> </b...
Read more

laravel - PDOException in Connector.php line 55: SQLSTATE[HY000] [1045] Access denied for user 'root'@'localhost' (using password: YES) -

-
my .env: app_env=local app_debug=true app_key=myappkey app_url=http://localhost db_connection=mysql db_host=localhost db_port=3306 db_database=gestiontaller db_username=root db_password='root' cache_driver=file session_driver=file queue_driver=sync redis_host=127.0.0.1 redis_password=null redis_port=6379 mail_driver=smtp mail_host=mailtrap.io mail_port=2525 mail_username=null mail_password=null mail_encryption=null i've tried password ", ' , without, restarting server every time. i've tried changing localhost 172.0.0.1. yes, password correct, running mysql -u root -p introducing password root in prompt can go mysql. users table: +------------------+-----------+ | user | host | +------------------+-----------+ | debian-sys-maint | localhost | | mysql.sys | localhost | | root | localhost | | root1 | localhost | +------------------+-----------+ i've added homestead.yaml this: database_port: 3306 ...
Read more