Today's Best Video

this question has answer here: mysql “not in” query 5 answers i have database 3 columns: id , numbers1 , numbers2 . i doing query this: select id numbers numbers.numbers1 = numbers.numbers2; and getting result of in id column. assuming have 1,2,3,4,5 in id column , getting result 1,2,3 how show have left column? mean how show in result 4,5? , not 1,2,3 got in result? the simplest query opposite - instead of = , using != : select id numbers numbers.numbers1 != numbers.numbers2;

i'm trying query jena named model stored (precisely dbpedia tbox). storage done in following way dataset dataset = tdbfactory.createdataset(path); dataset.begin(readwrite.write); model model = dataset.getnamedmodel(graph); ontmodel ontmodel = modelfactory.createontologymodel(); model.add(filemanager.get().readmodel(ontmodel, dbpedia)); model.commit(); model.close(); dataset.commit(); dataset.end(); dataset.close(); path contains path tdb, graph contains name of named model , dbpedia contains path owl file. until point seems fine: when later want query model, following: dataset dataset = tdbfactory.createdataset(path); dataset.begin(readwrite.read); list<string> out = lists.newarraylist(); try(queryexecution qexec = queryexecutionfactory.create("select * { graph ?g {?s ?p ?o}}", dataset.getnamedmodel(graph))) { resultset rs = qexec.execselect(); resultsetformatter.out(rs); rs.foreachremaining(triple -> out.add(triple.tostring())); } cat

i have parent class named student. have created 2 children class permanentstudent , casualstudent extending this. have written constructors both extended child classes (both child class have own constructors). now, making array of size 10 of students out of 4 permanent students , 6 casualstudents. this, did follows: student[] = new student[10]; int count; now, wish fill array 4 permanent students objects , 6 casual student objects information through constructor. following, for (count = 0; count < 4; count++) { a[count] = new permanentstudent(a,b,c); // invoking constructor } (count = 4; count < 10; count++) { a[count] = new casualstudent(x,y); // invoking constructor of other class } but gives me compilation error. going wrong in this? thanks! assignment base base = new sub() or base[i] = new sub() in case legal in java. problem in constructors, check no-arguments constructor exists in student .

we migrating our jsf 1.2 project jsf 2.0 , using command button in jsp page .clicking command button reponse external system , display response. while clicking command button getting blank page below execption during debug found getting success response not able find original page lost state view id [8/13/13 11:01:30:538 cdt] 000000e0 webapp e com.ibm.ws.webcontainer.webapp.webapp logservleterror srve0293e: [servlet error]-[faces servlet]: java.lang.nullpointerexception: viewid parameter save view state null @ org.ajax4jsf.application.ajaxstateholder.savestate(ajaxstateholder.java:155) @ org.ajax4jsf.application.ajaxstatemanager.savestateinsession(ajaxstatemanager.java:523) @ org.ajax4jsf.application.ajaxstatemanager.buildviewstate(ajaxstatemanager.java:503) @ org.ajax4jsf.application.ajaxstatemanager.saveview(ajaxstatemanager.java:462) @ org.apache.myfaces.shared_impl.view.jspviewdeclarationlanguagebase.renderview(jspviewdeclarationlanguagebase.j

i've problem re-creation of activity, progress dialog , async task when change orientation of screen. saw solutions here , decided use onretaincustomnonconfigurationinstance() save instance of asynctask. well, in oncreate check if there instance of asynctask and, if exist, show new progress dialog. dialog blocks ui in infinite loop (in onpostexecute there dialog.dismiss() ) , activity doesn't show results of course. oncreate getdirection = (getdirection) getlastcustomnonconfigurationinstance(); if(getdirection != null) { dialog = new progressdialog(routeactivity.this); dialog.setmessage(getresources().getstring(r.string.loading_data)); dialog.setindeterminate(false); dialog.setcancelable(false); dialog.show(); } else { getdirection = new getdirection(); getdirection.execute(); } onretaincustomnonconfigurationinstance @override public object onretaincustomnonconfigurationinstance() { return getdirection; } @override protected void ondestroy() { s

in solution, have project (let's 'prj1' ) has type inside, myattribute1 implements uitypeeditor. in project,i reference prj1 , use myattribute1 attribute property. the problem is, when build solution, prj1.dll not copy in final solution dir. lead currentdomain_assemblyresolve fired. if create local field of type myattribut1e , ok! what problem? i'm missing here? sounds you're not referencing project project reference within solution, directly referencing .dll? try removing reference project using attribute, add reference again being careful select project projects section rather browsing .dll

i have file information, how looks like: ****alignment**** sequence: gi|86755972|gb|abd15130.1| cold acclimation protein cor413-pm1 [chimonanthus praecox] length: 201 e-value: 2.66576e-82 kylamktdqlavanmidsdinelkmatmrlindasmlghygfgthflkwlaclaaiyllildrtnwrtnmltsll... +ylamktd+ + +i +d+ e+ +l+ da+ lg g gt lkw+a aaiyllildrtnw+tnmlt+ll... eylamktdewsaqqliqtdlkemgkaakklvydatklgslgvgtsilkwvasfaaiyllildrtnwktnmltall... now want filter information, , want use variable. think should use regular expression this, don't know how lots of information of second line, example. i need hitsid , protein , organism , , evalue . the corresponding data: hitsid = 86755972 protein = cold acclimation protein cor413-pm1 organism = chimonanthus praecox evalue = 2.66576e-82 so want that, when ask hitsid , python prints ' 86755972 '. could me this? thanks! use regex like ^sequence:[^|]*\|(?p<hitsid>[^|]*)\|\s*\s*(?p<protein>[^][]*?)\s*\[(?p<organism

i'm new web2py , unable understand error ticket throwing up. can explain error , why occurring? ticket id 127.0.0.1.2016-05-28.15-45-10.493c5f3c-e5f2-4034-8e82-69637b1fcc35 <type 'exceptions.syntaxerror'> invalid table/column name "size" "all" reserved sql/nosql keyword version web2py™ version 2.12.1-stable+timestamp.2015.08.07.07.22.06 traceback (most recent call last): file "c:\users\sharankumar\desktop\new\gluon\restricted.py", line 227, in restricted exec ccode in environment file "c:/users/sharankumar/desktop/new/applications/mylogin/models/db.py", line 232, in <module> format='%(name)s') file "c:\users\sharankumar\desktop\new\gluon\packages\dal\pydal\base.py", line 817, in define_table table = self.lazy_define_table(tablename,*fields,**args) file "c:\users\sharankumar\desktop\new\gluon\packages\dal\pydal\base.py", line 834, in lazy_define_table table = tabl

i have insert 40 million records .csv file database , below process followed. windows service 1: reading csv validating records inserting valid records success table (intermediate table) using sqlbulkcopy . windows service 2. getting 10 000 records success table @ time running foreach these 10 000 sending each record database insert main table. windows service 1 takes 30-40 min windows service 2 takes 5 hours complete task (minimum time). have 2 ways cannot decide better , open suggestions. creating 4 separate windows service , processing 40000 records simultaneously using job watch can use while loop calling procedure async windows service my biggest doubt here using transactions in procedure , async work because per assumption using transaction locks table , other process needs work on it. i think using wrong tool job. c# apps might trick there more powerful way using integration services. i guessing here, these tables in middle transform or

i trying develop app display images meta data i.e. imagename , imagepath , capturingdate , size , extension. want to use broadcast receiver , whenever open gallery , click on image shows data in toast . please can me? public class cameraeventreceiver extends broadcastreceiver { private uri imageuri; string getimgname, getimgpath; private databasehelper dbhelp; public void onreceive(context context, intent intent) { dbhelp = new databasehelper(context); sqlitedatabase db = dbhelp.getwritabledatabase(); calendar c = calendar.getinstance(); int s = c.get(calendar.second); int m = c.get(calendar.minute); int h = c.get(calendar.hour); int day = c.get(calendar.date); int month = c.get(calendar.month); int year = c.get(calendar.year); intent = new intent(mediastore.action_image_capture); file photo = new file(environment.getexternalstoragedirectory(

i've been using crashlytics in application, our client using hockeyapp, , came know recent updates google firebase. has had chance use above tools, overview , suggestion? did 1 on other... , why? have great day. i'm afraid can't speak hockeyapp @ all, have experience in using firebase , crashlytics using ios , android clients. below paragraphs don't factor in hockeyapp, , compare firebase crash reporting crashlytics. of two, depend on crashlytics crash reporting until firebase can further revise features. i've implemented both in apps, , there advantages crashlytics. send email notifications when crashes occur, including priority changes, , crashes appear in interface, within 5 minutes typically. as stands, firebase doesn't have crash notifications, , can take 20-40 minutes crash report appear in dashboard. benefit of using firebase's reporting analytics create audience group of crash experiencing users, allowing identify , provide diffe

i new spring boot , have read on docs several articles, , having difficult time serving single static html page. think complicating things here have 2 requirements can't bend on, , don't think docs or these articles address requirements: i want use yaml external config (so application.yml ); and i want external config external ! is, don't want packaged inside uberjar, rather, want deployed along uberjar, decoupled artifact. allows me run same uberjar on environment config file has been deployed. so start with, have added usual starter poms on compile classpath (mentioning clear snake yaml should on classpath): compile( 'org.codehaus.groovy:groovy-all:2.4.6' ,'org.springframework.boot:spring-boot-starter-jetty' ,'org.springframework.boot:spring-boot-starter-actuator' ) compile('org.springframework.boot:spring-boot-starter-web') { exclude module: 'spring-boot-starter-tomcat' } next, add src/main/resourc

i using use flash; display flash messages not showing protected function store(request $request) { $this->validate($request, [ 'service_name' => 'required' ]); $service = new service(); $service->service_name = $request->input('service_name'); $service->business_id = auth::user()->user_id; $service->save(); flash::message('service added'); return redirect('/business/editservices'); } view code @if (session::has('flash_notification.message')) <div class="alert alert-{{ session::get('flash_notification.level') }}"> <button type="button" class="close" data-dismiss="alert" aria-hidden="true">&times;</button> {{ session::get('flash_notification.message') }} </div> @endif what might problem?please help if have request object use flash: protected functio

i know, can use recycleview, not problem. can use horizontalviews in recycleviews, not problem also.but failed start loading data start right-most end, failed do. there no binding have use recycleview. so, tried horizontal listview also. not load data right-most end it, also. any kind of appreciable. thanks in advance. set gravity of raw file layout end /right should work.

i have html table , want tried write add new row function using jquery.but not working. here sample jquery code: $('tr td input[type="checkbox"].yes').change(function() { $(this).closest('tr').find(":input:not(.yes)").prop('disabled', !this.checked); $(this).closest('tr').find(":input.no").prop('checked', !this.checked); }); $(".addmore").click(function() { var data = "<tr><td><input class='yes' type='checkbox' checked/></td><td><input type='text' value='4444'/></td><td><select><option>a</option><option>b</option></select></td><td><input type='text' value='dddd'/></td><td><select><option>a</option><option>b</option></select></td></tr>"; $('table').append(data);

i trying list tree of folders on c. of files , folders on c require admin rights , fs.stat throws error because of this. somehow check first fs.access rights , if no admin rights needed continue fs.stat. files , folders in array , i'm iterating through it. sadly don't callbacks work. can me this? appreciate every little help. fs.readdir(seedir, function (err, files) { if (err) { throw err; }; var filename = ''; var path = ''; var statcallback; (var = 0; < files.length; i++) { filename = files[i]; path = util.format('%s%s', seedir, filename); var islast = (i === (files.length - 1)); fs.access(path, fs.f_ok | fs.r_ok, function(err) { if (err) { console.log(err); } else { fs.stat(path, function (err, stats) { console.log(path); if (err) { throw err;

one topic closed @ time opened new topic: how save gvim settings? add vimrc file (.vimrc or _vimrc). change "yourcolor" existing real color name, ex: darkblue, etc if has('gui_running') colorscheme yourcolor endif

i'm creating module called qt ( github link ) alias module (for example pyqt4 ), when import qt in fact importing pyqt4 : from qt import qtwidgets # imports pyqt4.qtgui example qt module: # qt.py import sys import pyqt4.qt sys.modules["qt"] = pyqt4 pyqt4.qtwidgets = pyqt4.qtgui however, if add print sys @ end of qt.py, sys equals none : print sys >>> none why sys "break" , can avoid breaking it? this in python 2.7.11 on os x. @lol4t0 – here's example i'm using standard modules: # xyz.py import os import sys sys.modules['xyz'] = os print sys # print "none" so importing result in "none printed: $ python python 2.7.11 (default, jan 22 2016, 08:29:18) [gcc 4.2.1 compatible apple llvm 7.0.2 (clang-700.1.81)] on darwin type "help", "copyright", "credits" or "license" more information. >>> import xyz none when there no longer referenc

i have list of account connections between source , target accounts schema looks like var connectionrequestschema = new schema({ sourceaccountid: { type: schema.objectid, ref: 'account' }, targetaccountid: { type: schema.objectid, ref: 'account' }, status: { type: string, enum: ['pending', 'accept', 'decline'], trim: true } }); i want query documents sourceaccountid or targetaccountid equal queried accountid. i saw link how-to-find-a-document-where-either-one-or-another-field-matches-a-value relevant find docouments using stand find method in mongo. user.findone({ $or: [ {first_name: name}, {last_name: name}, ], }, function(err, user) { }) but using mongoose middleware , i'm not sure how construct condition. already find solution , write connectionrequest.find({ $or: [ {sourceaccountid: "5736eac90a39c2547cb9d911"}, {targetaccountid:

i link http://google.com use admin panel adminlte 2.3.3, click through point lessons not going on menu. <li class="treeview"> <a href="http://google.com"> <i class="fa fa-pie-chart"></i> <span>lessons</span> <i class="fa fa-angle-left pull-right"></i> </a> <ul class="treeview-menu"> <li><a href="#"><i class="fa fa-circle-o"></i> lessons1</a></li> <li><a href="#"><i class="fa fa-circle-o"></i> lessons2</a></li> </ul> </li> what mean "are not going on menu"? not sure understood problem...

is there benefit on using will-change property on html video tag increase performance ? if so, how should use in order make video run on gpu using hardware acceleration ? will-change used hint browser, property or content of corresponding dom-element change in near future. therefore requires value css-property (e.g. will-change: opacity ) or contents keyword ( will-change: contents ). if none of changed, see no reason using on video-tag.

def fun(f: int => unit) { f(10) f(20) } println("method 1 call:") fun(i => {println("hi"); println(i)}) println("method 2 call:") fun{println("hi"); println(_)} the output is: e:\test\scala>scala i.scala method 1 call: hi 10 hi 20 method 2 call: hi 10 20 i think i => {println("hi"); println(i)} , println("hi"); println(_) same. because have 1 parameter , parameter used once, can use _ simplify code. then, why method 2 print "hi" once? (does mean: if want use _ simple calling, contents on right of => can have 1 expression, if have more one, e.g. println("hi"); println(i); then, can not use _ replace? first, have know in scala { block; of; code } expression evaluates whatever last expression inside evaluates to. when say: fun(i => { println("hi"); println(i) }) you create anonymous function, body contains 2 expressions, both returning () , bot

dynamic memory allocation important topic in c programming. however, i've been unable find explanation of enables do, or why required. can't declare variables , structs , never have use malloc()? as side note, difference between: ptr_one = (int *)malloc(sizeof(int)); and int *ptr_one = malloc(sizeof(int)); you need use dynamic memory when: you cannot determine maximum amount of memory use @ compile time; you want allocate very large object; you want build data structures (containers) without fixed upper size; you don't know how memory need set aside @ compile time. imagine processing data file (a time series of temperatures, say), number of records in file isn't fixed. have few 10 records or many 100000. if want read data memory process it, won't know how memory allocate until read file. if file structured first value number of records, this: size_t recs = 0; double *temps = null; file *fp = fopen ( filename, "r" ); i

i have 3d numpy array of following form: array([[[ 1., 5., 4.], [ 1., 5., 4.], [ 1., 2., 4.]], [[ 3., 6., 4.], [ 6., 6., 4.], [ 6., 6., 4.]]]) is there efficient way convert 2d array of form: array([[1, 1, 1, 5, 5, 2, 4, 4, 4], [3, 6, 6, 6, 6, 6, 4, 4, 4]]) thanks lot! in [54]: arr = np.array([[[ 1., 5., 4.], [ 1., 5., 4.], [ 1., 2., 4.]], [[ 3., 6., 4.], [ 6., 6., 4.], [ 6., 6., 4.]]]) in [61]: arr.reshape((arr.shape[0], -1), order='f') out[61]: array([[ 1., 1., 1., 5., 5., 2., 4., 4., 4.], [ 3., 6., 6., 6., 6., 6., 4., 4., 4.]]) the array arr has shape (2, 3, 3) . wish keep first axis of length 2, , flatten 2 axes of length 3. if call arr.reshape(h, w) numpy attempt reshape arr shape (h, w) . if call arr.reshape(h, -1) numpy replace -1 whatever integ

i have file contain information : cant stop feeling! justin timberlake 1 dance drake featuring like separated "\t" my question how can take first string here "one dance " , put in string , take artist name "drake featuring "and put in using methods string class .

hi form_tag in haml , getting errors when convert erb, %h2 create new movie = form_tag movies_path, :method => :post = label :movie, :title, 'title' = text_field :movie, :title = label :movie, :rating, 'rating' = select :movie, :rating, ['g','pg','pg-13','r','nc-17'] = label :movie, :release_date, 'released on' = date_select :movie, :release_date = submit_tag 'save changes' below erb, <h2> create new movie </h2> <form action = <%= "#{movies_path}"%> method = "post"> <%= label :movie, :title, 'title' %> <%= text_field :movie, :title %> <%= label :movie, :rating, 'rating' %> <%= select :movie, :rating, ['g','pg','pg-13','r','nc-17'] %> <%= label :movie, :release_date, 'released on' %> <%= date_select :movie, :release_date %> <%= submit_tag &#

i'm using composite template document visibility enabled. signers correctly excluded documents don't have tabs on, or can explicitly excluded no signer has tabs on excludeddocuments parameter. my problem this : sender (me) cannot view 1 of documents in envelope sender not recipient of. according docs: recipients have administrative role (recipients action of manage envelopes, address recipients, manage recipients, receive copy or acknowledge receipt) can see documents in envelope, unless excluded when envelope sent. documents not have tags visible recipients, unless excluded when envelope sent. i tried adding sender recipient of document received error: free form signing not allowed document visibility which suggests need add signheretab sender -- there nothing sign, should view only. partial request, includes document in question. can see how sender not recipient on document. { "status":"sent", "composi

i having trouble integrating admob sdk mopub (in fabric). installed mopub through fabric installer. using ios swift, xcode version 7.3.1 (7d1014), base sdk ios 9.3, project deployment target ios 8.0. i able display mopub test ads in app runtime errors when displaying admob ads through mopub. i cannot find detailed instructions on how integrate admob sdk when using fabric mopub installer. instructions add third party libraries when using standalone mopub sdk. keep fabric mopub framework. after got mopub test ads working, followed these steps: i added googleadmobcustomevent.framework project, came in mopub-ios-custom-events.zip archive (found in https://dev.twitter.com/mopub/ios/mediation-fabric ) i added googlemobileads.framework (latest version google: v7.8.1) project. in mopub dashboard, created new order, 1 line item , 2 ad units (banner , leaderboard) admob network. when run project following error: 2016-05-28 12:03:57.662 mopubtest[43756:2148130] mopub: banner

how can assign uilabel in app nsstring expression? attempt was: @iboutlet weak var imput: uilabel! @iboutlet weak var output: uilabel! ... ... ... @ibaction func equal(sender: anyobject) { calculate = nsexpression(format: imput.text!) output = calculate.expressionvaluewithobject(nil, context: nil) as! uilabel } i had use output.text = ... instead of output = ... , instead of as! uilabel used 2 other variables convert nsexpression double , string.

i using bootstrap validator validate form created bootstrap. have used bootstrapvalidator function validate form , built in submithandle of function. in submithandle, using post method can see. major problem not able submit form after clicking submit button.you can run code snippet , can see after hitting submit button,it stuck , if change of above field , click submit again works fine. not able make work on first attempt. not able find bug....any appreciated. thanks!! $(document).ready( function() { var validator = $("#registration-form").bootstrapvalidator({ live: 'enabled', feedbackicons: { //valid: 'glyphicon glyphicon-ok', //invalid: 'glyphicon glyphicon-remove', validating: 'glyphicon glyphicon-refresh' }, fields: { fname: { message: "this field required", validators: { notempty: { messa

here code horizontal radio button: <xp:radiogroup id="apptype" value="#{ruledoc.apptype}" layout="linedirection"> <xp:selectitem itemlabel="applications"> </xp:selectitem> <xp:selectitem itemlabel="lotus notes db"> </xp:selectitem> <xp:selectitem itemlabel="lotus notes groups"> </xp:selectitem> <xp:selectitem itemlabel="folders"></xp:selectitem> <xp:selectitem itemlabel="hardware"></xp:selectitem> <xp:selectitem i

i have build libmemcached.a , copied /usr/local/lib on mac , have tried following options link libmemcached.a , yet compile time errors libmemcached/memcached.h not found. link_libraries (${libmemcached}) include_directories(system ${libmemcached}) link_directories("/usr/local/lib") find_package(libmemcached.a required) link_libraries`enter code here`(libmemcached.a) find_library(result libmemcached.a paths /usr/local/lib) target_link_libraries(dnsa_pcl libmemcached.a) it simple -l -l using makefile. not sure needs done make work using cmakelists. appreciated. you should use called imported library, it's described in official documentation

i have written mixed-ineteger model (mip) in gams , trying solve cplex. encountered error: cplex error 3019: failure solve mip subproblem i have 4 cores , 16 gb ram on pc. optimality gap set 1%. after lot of searching, found suggestions (no solution), , tried them all, yet no luck. every time takes 30min-60min until optimization terminates error. these combinations tried: i increased iteration limits 1 million. error 3019. some relaxation "feasoptmode 3". error 3019. give priority feasibility on optimality using "mipemphasis 1". error 3019. change algorithm solving subproblems using "subalg 3". error 3019. then adding relaxations: "feasopt 1", "feastoptmode 3", "mipemphasis 1". out-of-memory adding heuristics well: "feasopt 1", "feastoptmode 3", "mipemphasis 1", "fpheur 2" , "userheurfreq 20". out-of-memory "feasopt 1", "feastoptm

i have class student , 2 children classes, casualstudent , permanentstudent. doing right now. employee[] = new employee[10]; int count; a[0] = new permanentstudent("john", "lui", "hjfddfdfj"); a[1] = new permanentstudent("peter", "vamplew", "vam12345678"); a[2] = new permanentstudent("rudi", "skacel", "ska51515151"); a[3] = new casualstudent("katie","blackburn","bla41925612"); a[4] = new casualstudent("neal","stephenson","ste97527467"); a[5] = new casualstudent("neneh","cherry","che98765432"); a[6] = new casualstudent("chris","brookmyre","bro97635198"); a[7] = new casualstudent("grace","hopper","hop26554432"); a[8] = new casualstudent("randall","munroe","xkcd1234567"); a[9] = new casualstudent("kaylee",&

i have solution discretized differential equation given by f(i) where i spatial index. how can find difference between solution @ each adjacent time step? more clear: the solution defined array real,dimension(0:10) :: f i discretize differential equation , solve stepping forward in time. if time index k , portion of code do k=1,25 = 1,10 f(i) = f(i+1)+f(i-1)+f(i) end end i can print solution, f(i) @ each time step k following code print*, "print f(i) k=, k print "(//(5(5x,e22.14)))", f how can find difference between solution @ each adjacent time step? is, time steps k+1 , k . store value in new array g , has dimension given by real,dimension(0:10) :: g so trying find !g(i)=abs(f(i;k+1)-f(i;k))...not correct code. how can this? way implement code? not sure how using if /then statements or whatever code need needed this. thanks typically, in explicit time integration methods or iterative methods, have save l

i trying use lpsolver on project working on. (it contains both jar , dll s). when ran locally worked ( system.loadlibrary("lpsolver") ) trying upload amazon server running tomcat. can't tomcat server load class library correctly. tried include in kind of different locations , loading non seemed work. any idea how can accomplish ? thanks! edit: tried lots of stuff found on web, ways include class library need inside project , not reference through local vars.but project not seem recognize it. wanted upload amazon web server ( system32) guess because use free version option not included...

i using microsoft asp.net identity owin.one developer change connection string mysql after change connection string mssql instead of mysql give error in update-database command error 0175: ado.net provider invariant name 'mysql.data.mysqlclient' either not registered in machine or application config file, or not loaded. see inner exception details. @ system.data.entity.core.metadata.edm.storeitemcollection.loader.throwonnonwarningerrors() why search 'mysql.data.mysqlclient'?there no mysql.data.mysqlclient in project or webconfig or configuration here webconfig <?xml version="1.0" encoding="utf-8"?> <!-- more information on how configure asp.net application, please visit http://go.microsoft.com/fwlink/?linkid=169433 --> <configuration> <configsections> <!-- more information on entity framework configuration, visit http://go.microsoft.com/fwlink/?linkid=237468 --> <!-- more information on